PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00004.1_g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family CO-like
Protein Properties Length: 402aa    MW: 45545 Da    PI: 5.3912
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00004.1_g00007.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box24.36.4e-081356340
                 zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                             +r C+ + + +++++C  ++ +lC++C  + H+       H++v
  Rsa1.0_00004.1_g00007.1 13 ARACDSCVKRRARWYCAADDAFLCHSCDGKVHSAnplarrHERV 56
                             578***************************9*657888888876 PP

2CCT68.51.8e-23353396144
                      CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                              Rea+++RY+eKr+tR+F+KkirYe+RK +Ae+RpR+KGrFvk++
  Rsa1.0_00004.1_g00007.1 353 REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRS 396
                              9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003362.3E-91158IPR000315B-box-type zinc finger
PROSITE profilePS5011910.4091158IPR000315B-box-type zinc finger
PfamPF006431.4E-61356IPR000315B-box-type zinc finger
CDDcd000213.23E-81458No hitNo description
PfamPF062035.2E-18353395IPR010402CCT domain
PROSITE profilePS5101716.083353395IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
MKSLANVVGG KTARACDSCV KRRARWYCAA DDAFLCHSCD GKVHSANPLA RRHERVRLKS  60
ASPGHSSSSP PHPPTWHQGF TRKSRTRRGG KKSHAMVFHD LVPEMSSEDQ SFEVEEQLIF  120
EVPVLNPMGD EQRLNEPMET KIEFPLMSIC FKSSEEEDDN AESCLNGLFP TDIELAQFSA  180
DVEILLGGGA DREFHAMDEL GLGEMLKIDK EEVEEEEEVA TVKVCDLDDA DETTPFEISF  240
EYEYSQRTTF EEKDEKEDVE KNMIDVGSVN EISGSIKEEN NEKIHMLRLD YESVISTWGG  300
QGTPWTAHEP PQIDLNMLCC PTDSMVESGG EDHHHKYFRG LGLHMGDAGS GGREARVSRY  360
REKRRTRLFS KKIRYEVRKL NAEKRPRMKG RFVKRSSIAA AH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1363379RRTRLFSKKIRYEVRKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009127638.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 6
SwissprotQ8LG760.0COL6_ARATH; Zinc finger protein CONSTANS-LIKE 6
TrEMBLM4EYN30.0M4EYN3_BRARP; Uncharacterized protein
STRINGBra033925.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24672767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68520.10.0B-box type zinc finger protein with CCT domain